FBXO44 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2088324
| Artikelname: |
FBXO44 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2088324 |
| Hersteller Artikelnummer: |
orb2088324 |
| Alternativnummer: |
BYT-ORB2088324-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human FBXO44 |
| Konjugation: |
FITC |
| Alternative Synonym: |
FBG3, FBX30, FBX6A, Fbx44, Fbxo6a |
| FBXO44 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
28kDa |
| NCBI: |
149438 |
| UniProt: |
Q9H4M3 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG |
