FBXO44 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2088324
Article Name: FBXO44 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088324
Supplier Catalog Number: orb2088324
Alternative Catalog Number: BYT-ORB2088324-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FBXO44
Conjugation: FITC
Alternative Names: FBG3, FBX30, FBX6A, Fbx44, Fbxo6a
FBXO44 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 149438
UniProt: Q9H4M3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG