NSUN5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089005
Artikelname: NSUN5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089005
Hersteller Artikelnummer: orb2089005
Alternativnummer: BYT-ORB2089005-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NSUN5
Konjugation: FITC
Alternative Synonym: NOL1, p120, NOL1R, NSUN5A, WBSCR20, WBSCR20A, p120(NOL1)
NSUN5 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 683759
UniProt: Q96P11
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA