NSUN5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2089005
| Article Name: |
NSUN5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2089005 |
| Supplier Catalog Number: |
orb2089005 |
| Alternative Catalog Number: |
BYT-ORB2089005-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NSUN5 |
| Conjugation: |
FITC |
| Alternative Names: |
NOL1, p120, NOL1R, NSUN5A, WBSCR20, WBSCR20A, p120(NOL1) |
| NSUN5 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
50kDa |
| NCBI: |
683759 |
| UniProt: |
Q96P11 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA |
