FASTKD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089138
Artikelname: FASTKD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089138
Hersteller Artikelnummer: orb2089138
Alternativnummer: BYT-ORB2089138-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FASTKD3
Konjugation: Biotin
FASTKD3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 076996
UniProt: Q14CZ7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TMETLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEP