FASTKD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089138
Article Name: FASTKD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089138
Supplier Catalog Number: orb2089138
Alternative Catalog Number: BYT-ORB2089138-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FASTKD3
Conjugation: Biotin
FASTKD3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 076996
UniProt: Q14CZ7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TMETLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEP