GLT25D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089210
Artikelname: GLT25D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089210
Hersteller Artikelnummer: orb2089210
Alternativnummer: BYT-ORB2089210-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GLT25D2
Konjugation: Biotin
Alternative Synonym: C1orf17, GLT25D2, ColGalT 2
GLT25D2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 055916
UniProt: Q8IYK4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEAL