GLT25D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089210
Article Name: GLT25D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089210
Supplier Catalog Number: orb2089210
Alternative Catalog Number: BYT-ORB2089210-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GLT25D2
Conjugation: Biotin
Alternative Names: C1orf17, GLT25D2, ColGalT 2
GLT25D2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 055916
UniProt: Q8IYK4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEAL