Tex35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089348
Artikelname: Tex35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089348
Hersteller Artikelnummer: orb2089348
Alternativnummer: BYT-ORB2089348-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Tex35
Konjugation: Biotin
Alternative Synonym: TSC24, C1orf49
Tex35 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 19kDa
UniProt: Q5T0J7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPC