Tex35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089348
Article Name: Tex35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089348
Supplier Catalog Number: orb2089348
Alternative Catalog Number: BYT-ORB2089348-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Tex35
Conjugation: Biotin
Alternative Names: TSC24, C1orf49
Tex35 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 19kDa
UniProt: Q5T0J7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPC