SHROOM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089462
Artikelname: SHROOM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089462
Hersteller Artikelnummer: orb2089462
Alternativnummer: BYT-ORB2089462-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SHROOM1
Konjugation: Biotin
Alternative Synonym: APXL2
SHROOM1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 001166171
UniProt: Q2M3G4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLPAPREETRLENPATHPVLDQPCGQGLPAPNNSIQGKKVELAARLQKML