SHROOM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089462
Article Name: SHROOM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089462
Supplier Catalog Number: orb2089462
Alternative Catalog Number: BYT-ORB2089462-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SHROOM1
Conjugation: Biotin
Alternative Names: APXL2
SHROOM1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 001166171
UniProt: Q2M3G4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LLPAPREETRLENPATHPVLDQPCGQGLPAPNNSIQGKKVELAARLQKML