Cplane2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2089495
| Artikelname: |
Cplane2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2089495 |
| Hersteller Artikelnummer: |
orb2089495 |
| Alternativnummer: |
BYT-ORB2089495-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Rs, Rsg1, Gm723, b2b2804C, b2b2827C, b2b2804Clo, b2b2827Clo, 6330545A04Rik |
| Cplane2 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
28kDa |
| NCBI: |
001074643 |
| UniProt: |
A2A825 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP |
