Cplane2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089495
Article Name: Cplane2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089495
Supplier Catalog Number: orb2089495
Alternative Catalog Number: BYT-ORB2089495-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik
Conjugation: Biotin
Alternative Names: Rs, Rsg1, Gm723, b2b2804C, b2b2827C, b2b2804Clo, b2b2827Clo, 6330545A04Rik
Cplane2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 001074643
UniProt: A2A825
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP