P4HA3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089572
Artikelname: P4HA3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089572
Hersteller Artikelnummer: orb2089572
Alternativnummer: BYT-ORB2089572-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human P4HA3
Konjugation: FITC
P4HA3 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 878907
UniProt: Q7Z4N8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD