P4HA3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089572
Article Name: P4HA3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089572
Supplier Catalog Number: orb2089572
Alternative Catalog Number: BYT-ORB2089572-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human P4HA3
Conjugation: FITC
P4HA3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 878907
UniProt: Q7Z4N8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD