NENF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089586
Artikelname: NENF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089586
Hersteller Artikelnummer: orb2089586
Alternativnummer: BYT-ORB2089586-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NENF
Konjugation: HRP
Alternative Synonym: CIR2, SPUF, SCIRP10
NENF Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 037481
UniProt: Q9UMX5
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAP