NENF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089586
Article Name: NENF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089586
Supplier Catalog Number: orb2089586
Alternative Catalog Number: BYT-ORB2089586-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NENF
Conjugation: HRP
Alternative Names: CIR2, SPUF, SCIRP10
NENF Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 037481
UniProt: Q9UMX5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAP