KDELC2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089649
Artikelname: KDELC2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089649
Hersteller Artikelnummer: orb2089649
Alternativnummer: BYT-ORB2089649-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KDELC2
Konjugation: HRP
Alternative Synonym: KDELC2
KDELC2 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 714916
UniProt: Q7Z4H8
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: SWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKEKE