KDELC2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089649
Article Name: KDELC2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089649
Supplier Catalog Number: orb2089649
Alternative Catalog Number: BYT-ORB2089649-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KDELC2
Conjugation: HRP
Alternative Names: KDELC2
KDELC2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 714916
UniProt: Q7Z4H8
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKEKE