H2AFJ Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089667
Artikelname: H2AFJ Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089667
Hersteller Artikelnummer: orb2089667
Alternativnummer: BYT-ORB2089667-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFJ
Konjugation: HRP
Alternative Synonym: H2AFJ
H2AFJ Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 808760
UniProt: Q9BTM1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE