H2AFJ Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089667
Article Name: H2AFJ Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089667
Supplier Catalog Number: orb2089667
Alternative Catalog Number: BYT-ORB2089667-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFJ
Conjugation: HRP
Alternative Names: H2AFJ
H2AFJ Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 808760
UniProt: Q9BTM1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE