PIK3C2A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2090862
| Artikelname: |
PIK3C2A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2090862 |
| Hersteller Artikelnummer: |
orb2090862 |
| Alternativnummer: |
BYT-ORB2090862-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of human PIK3C2A |
| Konjugation: |
FITC |
| Alternative Synonym: |
CPK, OCSKD, PI3-K-C2A, PI3K-C2alpha, PI3K-C2-alpha, PI3-K-C2(ALPHA) |
| PIK3C2A Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
143kDa |
| NCBI: |
002636 |
| UniProt: |
O00443 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRE |
