PIK3C2A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090862
Article Name: PIK3C2A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090862
Supplier Catalog Number: orb2090862
Alternative Catalog Number: BYT-ORB2090862-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PIK3C2A
Conjugation: FITC
Alternative Names: CPK, OCSKD, PI3-K-C2A, PI3K-C2alpha, PI3K-C2-alpha, PI3-K-C2(ALPHA)
PIK3C2A Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 143kDa
NCBI: 002636
UniProt: O00443
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRE