LIMS2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2090996
Artikelname: LIMS2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2090996
Hersteller Artikelnummer: orb2090996
Alternativnummer: BYT-ORB2090996-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIMS2
Konjugation: HRP
Alternative Synonym: LGMD2W, PINCH2, MDRCMTT, PINCH-2
LIMS2 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 001154876
UniProt: Q7Z4I7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR