LIMS2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090996
Article Name: LIMS2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090996
Supplier Catalog Number: orb2090996
Alternative Catalog Number: BYT-ORB2090996-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIMS2
Conjugation: HRP
Alternative Names: LGMD2W, PINCH2, MDRCMTT, PINCH-2
LIMS2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 001154876
UniProt: Q7Z4I7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR