SHOC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091454
Artikelname: SHOC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091454
Hersteller Artikelnummer: orb2091454
Alternativnummer: BYT-ORB2091454-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SHOC2
Konjugation: Biotin
Alternative Synonym: SOC2, SUR8, NSLH1, SIAA0862
SHOC2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 031399
UniProt: Q9UQ13
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQL