SHOC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091454
Article Name: SHOC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091454
Supplier Catalog Number: orb2091454
Alternative Catalog Number: BYT-ORB2091454-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SHOC2
Conjugation: Biotin
Alternative Names: SOC2, SUR8, NSLH1, SIAA0862
SHOC2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 031399
UniProt: Q9UQ13
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQL