WWC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2092051
Artikelname: WWC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2092051
Hersteller Artikelnummer: orb2092051
Alternativnummer: BYT-ORB2092051-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WWC1
Konjugation: Biotin
Alternative Synonym: KIBRA, HBEBP3, HBEBP36, MEMRYQTL, PPP1R168
WWC1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 125kDa
NCBI: 056053
UniProt: Q8IX03
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLEDSW