WWC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2092051
Article Name: WWC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2092051
Supplier Catalog Number: orb2092051
Alternative Catalog Number: BYT-ORB2092051-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WWC1
Conjugation: Biotin
Alternative Names: KIBRA, HBEBP3, HBEBP36, MEMRYQTL, PPP1R168
WWC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 125kDa
NCBI: 056053
UniProt: Q8IX03
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLEDSW