ZNF346 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2094724
Artikelname: ZNF346 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2094724
Hersteller Artikelnummer: orb2094724
Alternativnummer: BYT-ORB2094724-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN346
Konjugation: Biotin
Alternative Synonym: JAZ, Zfp346
ZNF346 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
UniProt: Q9UL40
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKL