ZNF346 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2094724
Article Name: ZNF346 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2094724
Supplier Catalog Number: orb2094724
Alternative Catalog Number: BYT-ORB2094724-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN346
Conjugation: Biotin
Alternative Names: JAZ, Zfp346
ZNF346 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32kDa
UniProt: Q9UL40
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKL