PTGDR Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2096246
Artikelname: PTGDR Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2096246
Hersteller Artikelnummer: orb2096246
Alternativnummer: BYT-ORB2096246-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PTGDR
Konjugation: HRP
Alternative Synonym: DP, AS1, DP1, ASRT1, PTGDR1
PTGDR Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 000944
UniProt: Q13258
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF