PTGDR Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2096246
Article Name: PTGDR Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096246
Supplier Catalog Number: orb2096246
Alternative Catalog Number: BYT-ORB2096246-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PTGDR
Conjugation: HRP
Alternative Names: DP, AS1, DP1, ASRT1, PTGDR1
PTGDR Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 000944
UniProt: Q13258
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF