DDO Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2096256
Artikelname: DDO Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2096256
Hersteller Artikelnummer: orb2096256
Alternativnummer: BYT-ORB2096256-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DDO
Konjugation: FITC
Alternative Synonym: DASOX, DDO-1, DDO-2
DDO Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 004023
UniProt: Q99489
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL