DDO Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2096256
Article Name: DDO Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096256
Supplier Catalog Number: orb2096256
Alternative Catalog Number: BYT-ORB2096256-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DDO
Conjugation: FITC
Alternative Names: DASOX, DDO-1, DDO-2
DDO Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 004023
UniProt: Q99489
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL