DDO Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2096258
Artikelname: DDO Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2096258
Hersteller Artikelnummer: orb2096258
Alternativnummer: BYT-ORB2096258-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDO
Konjugation: HRP
Alternative Synonym: DASOX, DDO-1, DDO-2
DDO Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 003640
UniProt: Q99489
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: TQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV