DDO Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2096258
Article Name: DDO Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096258
Supplier Catalog Number: orb2096258
Alternative Catalog Number: BYT-ORB2096258-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDO
Conjugation: HRP
Alternative Names: DASOX, DDO-1, DDO-2
DDO Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 003640
UniProt: Q99489
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV