HCCS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096542
Artikelname: HCCS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096542
Hersteller Artikelnummer: orb2096542
Alternativnummer: BYT-ORB2096542-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HCCS
Konjugation: Biotin
Alternative Synonym: MLS, CCHL, MCOPS7, LSDMCA1
HCCS Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 005324
UniProt: P53701
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTIL