HCCS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096542
Article Name: HCCS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096542
Supplier Catalog Number: orb2096542
Alternative Catalog Number: BYT-ORB2096542-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HCCS
Conjugation: Biotin
Alternative Names: MLS, CCHL, MCOPS7, LSDMCA1
HCCS Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 005324
UniProt: P53701
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTIL