Map2k1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096554
Artikelname: Map2k1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096554
Hersteller Artikelnummer: orb2096554
Alternativnummer: BYT-ORB2096554-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Map2k1
Konjugation: Biotin
Alternative Synonym: Mek1, Prkm, MEKK1, MAPKK1, Prkmk1
Map2k1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 032953
UniProt: P31938
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAF