Map2k1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096554
Article Name: Map2k1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096554
Supplier Catalog Number: orb2096554
Alternative Catalog Number: BYT-ORB2096554-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Map2k1
Conjugation: Biotin
Alternative Names: Mek1, Prkm, MEKK1, MAPKK1, Prkmk1
Map2k1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 032953
UniProt: P31938
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAF