Casp3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2096623
| Artikelname: |
Casp3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2096623 |
| Hersteller Artikelnummer: |
orb2096623 |
| Alternativnummer: |
BYT-ORB2096623-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Casp3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Ya, AC-, CC3, CPP, mld, AC-3, Casp, Lice, Yama, mldy, CPP32, SCA-1, CASP-3, CPP-32, Caspase-3, A830040C14Rik |
| Casp3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
31kDa |
| NCBI: |
033940 |
| UniProt: |
P70677 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTA |
