Casp3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2096623
| Article Name: |
Casp3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2096623 |
| Supplier Catalog Number: |
orb2096623 |
| Alternative Catalog Number: |
BYT-ORB2096623-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Casp3 |
| Conjugation: |
Biotin |
| Alternative Names: |
Ya, AC-, CC3, CPP, mld, AC-3, Casp, Lice, Yama, mldy, CPP32, SCA-1, CASP-3, CPP-32, Caspase-3, A830040C14Rik |
| Casp3 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
31kDa |
| NCBI: |
033940 |
| UniProt: |
P70677 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTA |
