ZC3H12C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096731
Artikelname: ZC3H12C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096731
Hersteller Artikelnummer: orb2096731
Alternativnummer: BYT-ORB2096731-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-ZC3H12C antibody is: synthetic peptide directed towards the C-terminal region of Human ZC12C
Konjugation: Biotin
Alternative Synonym: MCPIP3
ZC3H12C Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 97 kDa
UniProt: Q9C0D7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQSDPSIRTQV