ZC3H12C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2096731
| Article Name: |
ZC3H12C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2096731 |
| Supplier Catalog Number: |
orb2096731 |
| Alternative Catalog Number: |
BYT-ORB2096731-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen for Anti-ZC3H12C antibody is: synthetic peptide directed towards the C-terminal region of Human ZC12C |
| Conjugation: |
Biotin |
| Alternative Names: |
MCPIP3 |
| ZC3H12C Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
97 kDa |
| UniProt: |
Q9C0D7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQSDPSIRTQV |
