NGRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096770
Artikelname: NGRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096770
Hersteller Artikelnummer: orb2096770
Alternativnummer: BYT-ORB2096770-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NGRN
Konjugation: Biotin
Alternative Synonym: DSC92
NGRN Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32 kDa
NCBI: 001028260
UniProt: Q9NPE2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEV