NGRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096770
Article Name: NGRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096770
Supplier Catalog Number: orb2096770
Alternative Catalog Number: BYT-ORB2096770-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NGRN
Conjugation: Biotin
Alternative Names: DSC92
NGRN Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32 kDa
NCBI: 001028260
UniProt: Q9NPE2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEV