PCSK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096803
Artikelname: PCSK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096803
Hersteller Artikelnummer: orb2096803
Alternativnummer: BYT-ORB2096803-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence RITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVP
Konjugation: Biotin
Alternative Synonym: FH3, PC9, FHCL3, NARC1, LDLCQ1, NARC-1, HCHOLA3
PCSK9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 74 kDa
NCBI: 777596
UniProt: Q8NBP7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVP