PCSK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096803
Article Name: PCSK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096803
Supplier Catalog Number: orb2096803
Alternative Catalog Number: BYT-ORB2096803-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence RITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVP
Conjugation: Biotin
Alternative Names: FH3, PC9, FHCL3, NARC1, LDLCQ1, NARC-1, HCHOLA3
PCSK9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 74 kDa
NCBI: 777596
UniProt: Q8NBP7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVP